SEO report of masterrainwatertanksperthwa.com.au

Master Rainwater Tanks Perth WA – Biggest Range and Best ...

masterrainwatertanksperthwa.com.au/

Error! The "meta description" is missing, the page has no summary description!


 Tasks

  • Avoid using deprecated HTML tags.
  • Try to make your site load faster.

 SEO

URL

Domain : masterrainwatertanksperthwa.com.au/

Character length : 35

Title
Master Rainwater Tanks Perth WA – Biggest Range and Best Prices for Rainwater Tanks in Perth Western Australia
Keywords (meta keywords)
Good! The website does not use “meta keywords”.
Open Graph Protocol

Error! The website does not use the OG (Open Graph) protocol.

Dublin Core
Dublin Core is not used
Underscores in the URLs
Good! No underscore (_) found in the URLs.
Search engine friendly URLs
Good! The website uses SEO friendly URLs.
Checking the robots.txt file
There is robots.txt file.
https://masterrainwatertanksperthwa.com.au/robots.txt
User-agentDisallowed for the search engines
*
  • /wp-admin/


 Social

Social Engagement

No info found.

 Content

Doctype
HTML 5
Encoding
Perfect! The character encoding is set: UTF-8.
Language
We have found the language localisation: ”en”.
Title
Master Rainwater Tanks Perth WA – Biggest Range and Best Prices for Rainwater Tanks in Perth Western Australia

Character length : 116

Improve! The website address (title) should be between 10 and 70 characters in length.
Text / HTML ratio
Ratio : 4%

Error! The text / HTML code ratio is under 15 percent on this website. This value shows that the website has relatively few text content.
Headings
H1H2H3H4H5H6
101100
Heading structure in the source code
  • <H1> Welcome to Master Rainwater Tanks Perth WA
  • <H4> Choose a section below to view the products in that range Or visit our main website - www.tankmaster.com.au - for our full range of products
  • <H3> Contact Us
Word cloud
  • tanks22
  • poly8
  • range6
  • perth6
  • rainwater5
  • master4
  • fire4
  • water3
  • eave3
  • fighting3
  • products3
  • supply3
  • aquaplate3
  • under3
  • ultimate2
  • round2
  • drains2
  • leach2
  • septic2
  • mounted2
  • units2
  • variety2
  • main2
  • full2
  • hose2
  • welcome2
  • underground2
  • wide2
  • tank2
  • email2
  • cartage2
  • australia2
Keyword matrix
wordtitledescriptionsheading
tanks
poly
range
perth
rainwater
master
Two Word cloud
  • tanks poly5
  • perth rainwater2
  • rainwater tanks2
  • eave tanks2
  • tanks perth2
Three Word cloud
  • ultimate perth rainwater2
404 Page
The website has a 404 error page.
Flash content
Good! The website does not have any flash contents.
Frame
Good! The website does not use iFrame solutions.
Images
We found 19 images on this web page.

Alternate attributes for the following 4 images are missing. Search engines use "alt" tags to understand image content efficiently. We strongly recommend fixing this issue.

 Readability

Flesch–Kincaid Grade Level
2.40
Flesch Reading Ease
89.60
Coleman Liau Index
7.10
Automated Readability Index (ARI)
0.30
Dale–Chall Readability
8.10
SMOG Index
7.90
Spache Readibility
5.00
Number of letters
5808
Number of words
1494
Number of sentences
221
Average words per sentences
7
Number of syllables
1949
Syllables in words
1843
Average syllables in words
1.30
Number of words in first three syllables
147
Percentage of word / syllables
9.84
Words not in Dale-Chall easy-word list
738
Words not in Spache easy-word list
188

 Technologies

Mobile optimization
This website is optimal for mobile devices!
Deprecated HTML elements
Good! No deprecated HTML tags are detected.
Redirection (www / not www)
Good! The web address is accessible in only one version. The www version is redirected to the version without www.
Deprecated HTML elements
Good! No deprecated HTML tags are detected.
Printability
Suggestion! Unfortunately, no printer-friendly CSS found.
Meta Tag (viewport tag, mobile devices)
Error! The meta tag named viewport is missing.

 Speed test

Server response time
The server response time is fast enough.
Loading time
10,068 ms
Table layout
Good! No nested tables found.
Render blocking resources
Good! No render blocking elements found!

 Speed test – Javascript

Javascript
Error! Too many javascript files found which slows down the page load on the website.
  • http://masterrainwatertanksperthwa.com.au/wp-includes/js/jquery/jquery.js?ver=1.12.4
  • http://masterrainwatertanksperthwa.com.au/wp-includes/js/jquery/jquery-migrate.min.js?ver=1.4.1
  • http://masterrainwatertanksperthwa.com.au/wp-content/themes/vantage/inc/mobilenav/js/mobilenav.min.js?ver=2.5.4
  • http://masterrainwatertanksperthwa.com.au/wp-content/themes/vantage/js/jquery.flexslider.min.js?ver=2.1
  • http://masterrainwatertanksperthwa.com.au/wp-content/themes/vantage/js/jquery.touchSwipe.min.js?ver=1.6.6
  • http://masterrainwatertanksperthwa.com.au/wp-content/themes/vantage/js/jquery.theme-main.min.js?ver=2.5.4
  • http://masterrainwatertanksperthwa.com.au/wp-content/themes/vantage/js/jquery.fitvids.min.js?ver=1.0
  • http://masterrainwatertanksperthwa.com.au/wp-includes/js/wp-embed.min.js?ver=4.7.5
  • http://masterrainwatertanksperthwa.com.au/wp-content/plugins/ml-slider/assets/sliders/flexslider/jquery.flexslider-min.js?ver=3.4.1
  • http://masterrainwatertanksperthwa.com.au/wp-content/plugins/caldera-forms/assets/js/jquery.baldrick.min.js?ver=1.3.4.3
  • http://masterrainwatertanksperthwa.com.au/wp-content/plugins/caldera-forms/assets/js/ajax-core.min.js?ver=1.3.4.3
  • http://masterrainwatertanksperthwa.com.au/wp-content/plugins/caldera-forms/assets/js/fields.min.js?ver=1.3.4.3
  • http://masterrainwatertanksperthwa.com.au/wp-content/plugins/caldera-forms/assets/js/polyfiller.min.js?ver=1.3.4.3
  • http://masterrainwatertanksperthwa.com.au/wp-content/plugins/caldera-forms/assets/js/parsley.min.js?ver=1.3.4.3
  • http://masterrainwatertanksperthwa.com.au/wp-content/plugins/caldera-forms/assets/js/frontend-script-init.min.js?ver=1.3.4.3
File size of all javascript files combined
0.00
Javascript minifying
Great! The Javascript files are minified.

 Speed test – CSS

CSS
Error! Too many CSS files detected that slows down the page load.
  • http://masterrainwatertanksperthwa.com.au/wp-content/plugins/siteorigin-panels/css/front.css?ver=2.4.25
  • http://masterrainwatertanksperthwa.com.au/wp-content/themes/vantage/style.css?ver=4.7.5
  • http://masterrainwatertanksperthwa.com.au/wp-content/themes/master-rainwater-tanks-perth-wa/style.css?ver=4.7.5
  • http://masterrainwatertanksperthwa.com.au/wp-content/themes/master-rainwater-tanks-perth-wa/style.css?ver=2.5.4
  • http://masterrainwatertanksperthwa.com.au/wp-content/themes/vantage/fontawesome/css/font-awesome.css?ver=4.6.2
  • http://masterrainwatertanksperthwa.com.au/wp-content/themes/vantage/inc/mobilenav/css/mobilenav.css?ver=2.5.4
  • http://masterrainwatertanksperthwa.com.au/wp-content/plugins/ml-slider/assets/sliders/flexslider/flexslider.css?ver=3.4.1
  • http://masterrainwatertanksperthwa.com.au/wp-content/plugins/ml-slider/assets/metaslider/public.css?ver=3.4.1
  • http://masterrainwatertanksperthwa.com.au/wp-content/plugins/caldera-forms/assets/css/caldera-grid.css?ver=1.3.4.3
  • http://masterrainwatertanksperthwa.com.au/wp-content/plugins/caldera-forms/assets/css/caldera-form.css?ver=1.3.4.3
  • http://masterrainwatertanksperthwa.com.au/wp-content/plugins/caldera-forms/assets/css/caldera-alert.css?ver=1.3.4.3
  • http://masterrainwatertanksperthwa.com.au/wp-content/plugins/caldera-forms/assets/css/fields.min.css?ver=1.3.4.3
File size of all css files combined
0.00
CSS minifying
Great! The CSS elements are minified.

 Speed test – Compression

Uncompressed size of the of the HTML
0.00
Gzip compression
Your site uses compression.

 Speed test – Browser cache

Browser cache
The browser cache is set correctly for all elements.

 Speed test – Images

File size of all images combined
0.00
Image optimisation
All images are optimized.

 Website security

IP
202.74.68.220
External hidden links
Good! No hidden external links found
Looking for eval()
Good! No eval(bas64_decode()) scripts are found
Checking for XSS vulnerability
No XSS vulnerability found
Email encryption
Good! We have not found any unencrypted email addresses.

 Sites on same ip

wawatertanks.com

wawatertanks.com

multitechproductswa.com.au

multitechproductswa.com.au

masterrainwatertanksperthwa.com.au

masterrainwatertanksperthwa.com.au

alliancewatertanks.com.au

alliancewatertanks.com.au

ultimateperthrainwatertanks.com.au

ultimateperthrainwatertanks.com.au

masterwatertanks.com.au

masterwatertanks.com.au

masterwaterproducts.com.au

masterwaterproducts.com.au

allaboutwatercentre.com.au

allaboutwatercentre.com.au

westcoastwatertanks.com.au

westcoastwatertanks.com.au

 Icons

Favicon
Good! The website uses favicon.

 Order of Heading elements on mobile by position

  • H1 : Welcome to Master Rainwater Tanks Perth WA, ( 450px from top )
  • H4 : Choose a section below to view the products in that range Or visit our main website - - for our full range of products, ( 1286.390625px from top )

 Typos

asterrainwatertanksperthwa.com.au, mnasterrainwatertanksperthwa.com.au, nasterrainwatertanksperthwa.com.au, mhasterrainwatertanksperthwa.com.au, hasterrainwatertanksperthwa.com.au, masterrainwatertanksperthwa.com.au, asterrainwatertanksperthwa.com.au, mjasterrainwatertanksperthwa.com.au, jasterrainwatertanksperthwa.com.au, mkasterrainwatertanksperthwa.com.au, kasterrainwatertanksperthwa.com.au, mlasterrainwatertanksperthwa.com.au, lasterrainwatertanksperthwa.com.au, m asterrainwatertanksperthwa.com.au, asterrainwatertanksperthwa.com.au, msterrainwatertanksperthwa.com.au, maqsterrainwatertanksperthwa.com.au, mqsterrainwatertanksperthwa.com.au, mawsterrainwatertanksperthwa.com.au, mwsterrainwatertanksperthwa.com.au, mazsterrainwatertanksperthwa.com.au, mzsterrainwatertanksperthwa.com.au, masterrainwatertanksperthwa.com.au, msterrainwatertanksperthwa.com.au, maxsterrainwatertanksperthwa.com.au, mxsterrainwatertanksperthwa.com.au, massterrainwatertanksperthwa.com.au, mssterrainwatertanksperthwa.com.au, materrainwatertanksperthwa.com.au, masqterrainwatertanksperthwa.com.au, maqterrainwatertanksperthwa.com.au, maswterrainwatertanksperthwa.com.au, mawterrainwatertanksperthwa.com.au, maseterrainwatertanksperthwa.com.au, maeterrainwatertanksperthwa.com.au, maszterrainwatertanksperthwa.com.au, mazterrainwatertanksperthwa.com.au, masxterrainwatertanksperthwa.com.au, maxterrainwatertanksperthwa.com.au, mascterrainwatertanksperthwa.com.au, macterrainwatertanksperthwa.com.au, maserrainwatertanksperthwa.com.au, mastrerrainwatertanksperthwa.com.au, masrerrainwatertanksperthwa.com.au, mastferrainwatertanksperthwa.com.au, masferrainwatertanksperthwa.com.au, mastgerrainwatertanksperthwa.com.au, masgerrainwatertanksperthwa.com.au, mastherrainwatertanksperthwa.com.au, masherrainwatertanksperthwa.com.au, mastyerrainwatertanksperthwa.com.au, masyerrainwatertanksperthwa.com.au, mast5errainwatertanksperthwa.com.au, mas5errainwatertanksperthwa.com.au, mast6errainwatertanksperthwa.com.au, mas6errainwatertanksperthwa.com.au, mastrrainwatertanksperthwa.com.au, mastewrrainwatertanksperthwa.com.au, mastwrrainwatertanksperthwa.com.au, mastesrrainwatertanksperthwa.com.au, mastsrrainwatertanksperthwa.com.au, masterrainwatertanksperthwa.com.au, mastrrainwatertanksperthwa.com.au, mastedrrainwatertanksperthwa.com.au, mastdrrainwatertanksperthwa.com.au, mastefrrainwatertanksperthwa.com.au, mastfrrainwatertanksperthwa.com.au, masterrrainwatertanksperthwa.com.au, mastrrrainwatertanksperthwa.com.au, maste3rrainwatertanksperthwa.com.au, mast3rrainwatertanksperthwa.com.au, maste4rrainwatertanksperthwa.com.au, mast4rrainwatertanksperthwa.com.au, masterainwatertanksperthwa.com.au, mastererainwatertanksperthwa.com.au, masteerainwatertanksperthwa.com.au, masterdrainwatertanksperthwa.com.au, mastedrainwatertanksperthwa.com.au, masterfrainwatertanksperthwa.com.au, mastefrainwatertanksperthwa.com.au, mastergrainwatertanksperthwa.com.au, mastegrainwatertanksperthwa.com.au, master4,rainwatertanksperthwa.com.au, maste4,rainwatertanksperthwa.com.au, mastertrainwatertanksperthwa.com.au, mastetrainwatertanksperthwa.com.au, master5rainwatertanksperthwa.com.au, maste5rainwatertanksperthwa.com.au, masterainwatertanksperthwa.com.au, masterreainwatertanksperthwa.com.au, mastereainwatertanksperthwa.com.au, masterrdainwatertanksperthwa.com.au, masterdainwatertanksperthwa.com.au, masterrfainwatertanksperthwa.com.au, masterfainwatertanksperthwa.com.au, masterrgainwatertanksperthwa.com.au, mastergainwatertanksperthwa.com.au, masterr4,ainwatertanksperthwa.com.au, master4,ainwatertanksperthwa.com.au, masterrtainwatertanksperthwa.com.au, mastertainwatertanksperthwa.com.au, masterr5ainwatertanksperthwa.com.au, master5ainwatertanksperthwa.com.au, masterrinwatertanksperthwa.com.au, masterraqinwatertanksperthwa.com.au, masterrqinwatertanksperthwa.com.au, masterrawinwatertanksperthwa.com.au, masterrwinwatertanksperthwa.com.au, masterrazinwatertanksperthwa.com.au, masterrzinwatertanksperthwa.com.au, masterrainwatertanksperthwa.com.au, masterrinwatertanksperthwa.com.au, masterraxinwatertanksperthwa.com.au, masterrxinwatertanksperthwa.com.au, masterrasinwatertanksperthwa.com.au, masterrsinwatertanksperthwa.com.au, masterranwatertanksperthwa.com.au, masterraiunwatertanksperthwa.com.au, masterraunwatertanksperthwa.com.au, masterraijnwatertanksperthwa.com.au, masterrajnwatertanksperthwa.com.au, masterrainwatertanksperthwa.com.au, masterranwatertanksperthwa.com.au, masterrailnwatertanksperthwa.com.au, masterralnwatertanksperthwa.com.au, masterraionwatertanksperthwa.com.au, masterraonwatertanksperthwa.com.au, masterrai8nwatertanksperthwa.com.au, masterra8nwatertanksperthwa.com.au, masterrai9nwatertanksperthwa.com.au, masterra9nwatertanksperthwa.com.au, masterrai*nwatertanksperthwa.com.au, masterra*nwatertanksperthwa.com.au, masterraiwatertanksperthwa.com.au, masterrainbwatertanksperthwa.com.au, masterraibwatertanksperthwa.com.au, masterraingwatertanksperthwa.com.au, masterraigwatertanksperthwa.com.au, masterrainhwatertanksperthwa.com.au, masterraihwatertanksperthwa.com.au, masterrainjwatertanksperthwa.com.au, masterraijwatertanksperthwa.com.au, masterrainmwatertanksperthwa.com.au, masterraimwatertanksperthwa.com.au, masterrain watertanksperthwa.com.au, masterrai watertanksperthwa.com.au, masterrainatertanksperthwa.com.au, masterrainwqatertanksperthwa.com.au, masterrainqatertanksperthwa.com.au, masterrainwaatertanksperthwa.com.au, masterrainaatertanksperthwa.com.au, masterrainwsatertanksperthwa.com.au, masterrainsatertanksperthwa.com.au, masterrainwdatertanksperthwa.com.au, masterraindatertanksperthwa.com.au, masterrainweatertanksperthwa.com.au, masterraineatertanksperthwa.com.au, masterrainw1atertanksperthwa.com.au, masterrain1atertanksperthwa.com.au, masterrainw2atertanksperthwa.com.au, masterrain2atertanksperthwa.com.au, masterrainw3atertanksperthwa.com.au, masterrain3atertanksperthwa.com.au

More Sites

  • Title: alexcreditunion
  • Description:
  • Internet Protocol (IP) address: 52.206.163.161
  • Tech:
    • CMS
      • Wix.com - Free Website Builder
    • Other
      • Html (HyperText Markup Language)
      • Html5
      • Javascript
      • Php (Hypertext Preprocessor)
  • Title: TextStation Design: Web Development, Graphic Design & Advertising
  • Description: Malaysia Web design Malaysia e-commerce solution, web hosting, Flash and multimedia design services, website redesign, .my domain name, Flash web design, content management system, web application development website design, malaysia web design, malaysia website designing web design selangor website design malaysia website design kuala lumpur designing malaysia web website web design KL web design website malaysia e-commerce website design hosting web design web design professional website design, web design company webpage design web site design website design company website development website hosting internet marketing search engine optimization ecommerce web redesign website redesign website design malaysia website design
  • Internet Protocol (IP) address: 202.9.109.181
  • Tech:
    • Analytic
      • Google Analytics
    • Social
      • Facebook Box
    • Other
      • AJAX Libraries API
      • Carousel
      • CSS (Cascading Style Sheets)
      • Google Font API
      • Html (HyperText Markup Language)
      • Javascript
      • jQuery
      • Php (Hypertext Preprocessor)
  • Title: Edinburgh Divetech 1067 | Friendly BSAC Diving club based in central Edinburgh
  • Description: Welcome to Divetech, branch 1067 of the British Sub Aqua Club, based in Edinburgh, Scotland. For more information about Divetech take a look at the About Divetech page, for trip reports and to see what we've been up to this year take a look at the Dive Log and News pages.
  • Internet Protocol (IP) address: 192.0.78.24
  • Tech:
    • CMS
      • Wordpress CMS
    • Analytic
      • comScore
    • Advertisement
      • Skimlinks
    • Other
      • CSS (Cascading Style Sheets)
      • Gravatar
      • Html (HyperText Markup Language)
      • Html5
      • Javascript
      • Php (Hypertext Preprocessor)
      • Pingback
      • SVG (Scalable Vector Graphics)
  • Title: Sie sehen hier eine soeben freigeschaltete Homepage
  • Description:
  • Sites loading time: 140
  • Internet Protocol (IP) address: 81.169.145.105
  • Javascript total size: 0.00B
  • CSS total size: 0.00B
  • Image total size: 33.45KB
  • Total size: 33.95KB
  • Tech:
    • Other
      • Html (HyperText Markup Language)
  • Title: Axiom Retail Energy
  • Description:
  • Internet Protocol (IP) address: 104.131.188.190
  • Tech:
    • CDN
      • CloudFlare
    • Other
      • CSS (Cascading Style Sheets)
      • Html (HyperText Markup Language)
      • Html5
  • Title: CORDELIA HOTEL
  • Description: 000
  • Internet Protocol (IP) address: 112.175.184.19
  • Tech:
    • Analytic
      • Google Analytics
    • CDN
      • BootstrapCDN
      • Maxcdn
    • Other
      • Carousel
      • CSS (Cascading Style Sheets)
      • Flexslider
      • Font Awesome
      • Google Font API
      • Html (HyperText Markup Language)
      • Html5
      • Javascript
      • jQuery
      • jQuery UI
      • Php (Hypertext Preprocessor)
  • Title: baubleandseed
  • Description:
  • Sites loading time: 3421
  • Internet Protocol (IP) address: 54.236.178.191
  • Javascript total size: 3.15MB
  • CSS total size: 109.85KB
  • Image total size: 4.57KB
  • Total size: 3.28MB
  • Tech:
    • CMS
      • Wix.com - Free Website Builder
    • Other
      • Html (HyperText Markup Language)
      • Html5
      • Javascript
  • Title: The Right Computer Service – Let us help you with all your computer needs!
  • Description:
  • Internet Protocol (IP) address: 198.57.165.238
  • Tech:
    • CMS
      • Wordpress CMS
    • Analytic
      • Google Analytics
    • Other
      • CSS (Cascading Style Sheets)
      • Gravatar
      • Html (HyperText Markup Language)
      • Html5
      • Javascript
      • jQuery
      • Php (Hypertext Preprocessor)
      • Pingback
      • SVG (Scalable Vector Graphics)
  • Title: Gratulacje! Twoja domena została zarejestrowana w OVH!
  • Description: OVH wspiera Twój rozwój poprzez najlepsze rozwiązania www: domeny, hosting, serwery dedykowane, Cloud, Big Data...
  • Sites loading time: 2046
  • Internet Protocol (IP) address: 87.98.239.5
  • Javascript total size: 96.44KB
  • CSS total size: 0.00B
  • Image total size: 187.39KB
  • Total size: 285.10KB
  • Tech:
    • Other
      • CSS (Cascading Style Sheets)
      • Html (HyperText Markup Language)
      • Php (Hypertext Preprocessor)
  • Title: 【女子ライフ】男子禁制の恋愛トーク〜女子のお悩みを紹介!
  • Description: 女子の恋バナからお悩みまで、女子達のリアルな体験談を紹介します。
  • Sites loading time: 29151
  • Internet Protocol (IP) address: 157.112.152.61
  • Javascript total size: 90.53KB
  • CSS total size: 80.71KB
  • Image total size: 1.35MB
  • Total size: 1.61MB
  • Tech:
    • CMS
      • Wordpress CMS
    • CDN
      • BootstrapCDN
      • Maxcdn
    • Other
      • CSS (Cascading Style Sheets)
      • Font Awesome
      • Google Font API
      • Html (HyperText Markup Language)
      • Html5
      • Iframe
      • Javascript
      • Php (Hypertext Preprocessor)
      • Pingback
      • SVG (Scalable Vector Graphics)